Research Peptides
LL-37
Research use only
Strength
$154.00
per vial
Prices shown are what you pay at checkout, with no account needed. Buyers with a Restate account may see their own pricing when signed in.
1
A lot’s own chromatogram is printed on its Certificate of Analysis.
- Form
- Lyophilized powder vial
- Documentation
- No certificate is published for this product yet. Ask support what is on file.
- Shipping
- Ships from the US in protective packaging with tracking
About this compound
LL-37 is the only human cathelicidin antimicrobial peptide, a 37-residue fragment released from hCAP18. Research spans innate immunity, wound-healing models, and its broader immunomodulatory signaling.
Specification
- CAS number
- 154947-66-7
- Molecular formula
- C205H340N60O53
- Molecular weight
- 4493.33 g/mol
- Amino acid count
- 37
- Sequence
- [LL-37, 37 aa]
- Synonyms
- Cathelicidin antimicrobial peptide; hCAP-18(134-170)
Complete the order
Reconstitution solution and bacteriostatic water, ready in the same order.
Frequently asked
Is LL-37 third-party tested?
Every lot of LL-37 is tested for identity and purity by an independent laboratory. No certificate for this product is published in our library yet; ask support what is on file for the current lot.
Can I review the Certificate of Analysis before ordering?
No certificate for LL-37 is published in our library yet. Ask support before you order and we will tell you what documentation is on file for the current lot.
Who can order LL-37 5 mg?
Restate Health supplies qualified researchers, laboratories, and other qualified purchasers only — for research use only. Accounts are verified before ordering is enabled, and this product is not sold to the general public.
How quickly does it ship?
Orders confirmed before 12pm CT typically ship the same business day from our U.S. facility with tracking. Restate Health can confirm current lead time and cold-chain handling for your account.
What ships
- One sealed vial per unit ordered, labeled with name and strength
- Lot number printed on the label for COA lookup
- Protective packaging, shipped with tracking
Documentation
Certificates are added to the certificate library as they are published. None is listed for this product yet; ask support what is on file for the current lot.
Storage and handling
Store sealed vials refrigerated or as labeled, and protect contents from light. Reconstituted material should be handled per your lab's protocol. For laboratory research use only, not for human or veterinary use.
Related in Research Peptides
