Research Peptides
FOXO4-DRI
Research use only
Strength
10 mg
$490.00
per vial
Prices shown are what you pay at checkout, with no account needed. Buyers with a Restate account may see their own pricing when signed in.
1
A lot’s own chromatogram is printed on its Certificate of Analysis.
- Form
- Lyophilized powder vial
- Documentation
- No certificate is published for this product yet. Ask support what is on file.
- Shipping
- Ships from the US in protective packaging with tracking
About this compound
FOXO4-DRI is a retro-inverso peptide designed to disrupt the FOXO4-p53 interaction that keeps senescent cells alive. It is a standard tool compound in senolytic and cellular-ageing research.
Specification
- Purity
- Reported on each lot's certificate
- CAS number
- 2460055-10-9
- Molecular formula
- C228H388N86O64
- Molecular weight
- 5358.06 g/mol
- Amino acid count
- 46
- Sequence
- All-D retro-inverso 46-mer: ltlrkepaseiaqsileaysqngwanrrsggkrppprrrqrrkkrg (free N-terminus, free acid C-terminus)
- Synonyms
- FOXO4 D-Retro-Inverso peptide
- Physical form
- Lyophilized powder
- Solubility
- Soluble in bacteriostatic water; consult the product COA for specific solvent recommendations.
- Storage
- Store lyophilized at -20°C; protect from light and moisture. Reconstitute with bacteriostatic water; refrigerate reconstituted solution at 2-8°C.
Complete the order
Reconstitution solution and bacteriostatic water, ready in the same order.
Frequently asked
Is FOXO4-DRI third-party tested?
Every lot of FOXO4-DRI is tested for identity and purity by an independent laboratory. No certificate for this product is published in our library yet; ask support what is on file for the current lot.
Can I review the Certificate of Analysis before ordering?
No certificate for FOXO4-DRI is published in our library yet. Ask support before you order and we will tell you what documentation is on file for the current lot.
Who can order FOXO4-DRI 10 mg?
Restate Health supplies qualified researchers, laboratories, and other qualified purchasers only — for research use only. Accounts are verified before ordering is enabled, and this product is not sold to the general public.
How should it be stored and handled?
Supplied as lyophilized powder. Store lyophilized at -20°C; protect from light and moisture. Reconstitute with bacteriostatic water; refrigerate reconstituted solution at 2-8°C. Soluble in bacteriostatic water; consult the product COA for specific solvent recommendations.
How quickly does it ship?
Orders confirmed before 12pm CT typically ship the same business day from our U.S. facility with tracking. Restate Health can confirm current lead time and cold-chain handling for your account.
What ships
- One sealed vial per unit ordered, labeled with name and strength
- Lot number printed on the label for COA lookup
- Protective packaging, shipped with tracking
Documentation
Certificates are added to the certificate library as they are published. None is listed for this product yet; ask support what is on file for the current lot.
Storage and handling
Store sealed vials refrigerated or as labeled, and protect contents from light. Reconstituted material should be handled per your lab's protocol. For laboratory research use only, not for human or veterinary use.
Related in Research Peptides
